Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,155
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,140
  3. Avatar for Contenders 3. Contenders 63 pts. 9,133
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 9,112
  5. Avatar for Go Science 5. Go Science 37 pts. 9,075
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 9,032
  7. Avatar for Deleted group 7. Deleted group pts. 8,943
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,930
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,853
  10. Avatar for Deleted group 10. Deleted group pts. 8,709

  1. Avatar for abiogenesis 161. abiogenesis Lv 1 2 pts. 7,674
  2. Avatar for CerebralEcstasy 162. CerebralEcstasy Lv 1 2 pts. 7,664
  3. Avatar for boondog 163. boondog Lv 1 2 pts. 7,662
  4. Avatar for taminnugget 164. taminnugget Lv 1 2 pts. 7,646
  5. Avatar for armaholik 165. armaholik Lv 1 2 pts. 7,645
  6. Avatar for seigisusui 166. seigisusui Lv 1 2 pts. 7,619
  7. Avatar for aminaman 167. aminaman Lv 1 2 pts. 7,610
  8. Avatar for Tonet 168. Tonet Lv 1 1 pt. 7,606
  9. Avatar for SpikRMX 169. SpikRMX Lv 1 1 pt. 7,588
  10. Avatar for wanjiayu 170. wanjiayu Lv 1 1 pt. 7,577

Comments