Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,155
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,140
  3. Avatar for Contenders 3. Contenders 63 pts. 9,133
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 9,112
  5. Avatar for Go Science 5. Go Science 37 pts. 9,075
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 9,032
  7. Avatar for Deleted group 7. Deleted group pts. 8,943
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,930
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,853
  10. Avatar for Deleted group 10. Deleted group pts. 8,709

  1. Avatar for andrewxc 51. andrewxc Lv 1 37 pts. 8,744
  2. Avatar for drumpeter18yrs9yrs 52. drumpeter18yrs9yrs Lv 1 37 pts. 8,738
  3. Avatar for Deleted player 53. Deleted player 36 pts. 8,718
  4. Avatar for Hanto_FZ140E_4G 54. Hanto_FZ140E_4G Lv 1 35 pts. 8,709
  5. Avatar for Roukess 55. Roukess Lv 1 34 pts. 8,707
  6. Avatar for YeshuaLives 56. YeshuaLives Lv 1 34 pts. 8,703
  7. Avatar for grogar7 57. grogar7 Lv 1 33 pts. 8,697
  8. Avatar for bamh 58. bamh Lv 1 32 pts. 8,695
  9. Avatar for heather-1 59. heather-1 Lv 1 31 pts. 8,677
  10. Avatar for steveB 60. steveB Lv 1 31 pts. 8,677

Comments