Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698
  1. Avatar for franse 151. franse Lv 1 2 pts. 7,627
  2. Avatar for marie.p 152. marie.p Lv 1 2 pts. 7,618
  3. Avatar for Altercomp 153. Altercomp Lv 1 1 pt. 7,616
  4. Avatar for Satina 154. Satina Lv 1 1 pt. 7,610
  5. Avatar for TheChondrite 155. TheChondrite Lv 1 1 pt. 7,571
  6. Avatar for v4mp1r3 156. v4mp1r3 Lv 1 1 pt. 7,563
  7. Avatar for thalesdinmilet 157. thalesdinmilet Lv 1 1 pt. 7,548
  8. Avatar for 01010011111 158. 01010011111 Lv 1 1 pt. 7,534
  9. Avatar for momadoc 159. momadoc Lv 1 1 pt. 7,517
  10. Avatar for GreekCivilization 160. GreekCivilization Lv 1 1 pt. 7,498

Comments