Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698
  1. Avatar for leeshanay 161. leeshanay Lv 1 1 pt. 7,494
  2. Avatar for romanus 162. romanus Lv 1 1 pt. 7,491
  3. Avatar for Sunet 163. Sunet Lv 1 1 pt. 7,461
  4. Avatar for student01 164. student01 Lv 1 1 pt. 7,460
  5. Avatar for Flagg65a 165. Flagg65a Lv 1 1 pt. 7,450
  6. Avatar for wozzarelli 166. wozzarelli Lv 1 1 pt. 7,447
  7. Avatar for andrewxc 167. andrewxc Lv 1 1 pt. 7,443
  8. Avatar for fishercat 168. fishercat Lv 1 1 pt. 7,433
  9. Avatar for FreeFolder 169. FreeFolder Lv 1 1 pt. 7,433
  10. Avatar for DScott 170. DScott Lv 1 1 pt. 7,422

Comments