Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698
  1. Avatar for Deleted player 201. Deleted player pts. 7,074
  2. Avatar for maffem 202. maffem Lv 1 1 pt. 7,063
  3. Avatar for Close At Hand 203. Close At Hand Lv 1 1 pt. 7,056
  4. Avatar for HJCW 204. HJCW Lv 1 1 pt. 7,032
  5. Avatar for dpan 205. dpan Lv 1 1 pt. 7,006
  6. Avatar for pmelzer 206. pmelzer Lv 1 1 pt. 6,998
  7. Avatar for hahnhk 207. hahnhk Lv 1 1 pt. 6,990
  8. Avatar for Sydefecks 208. Sydefecks Lv 1 1 pt. 6,972
  9. Avatar for Needo 209. Needo Lv 1 1 pt. 6,964
  10. Avatar for felix1998 210. felix1998 Lv 1 1 pt. 6,959

Comments