Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,607
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,454
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,425
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,272
  5. Avatar for xkcd 15. xkcd 1 pt. 8,246
  6. Avatar for Deleted group 16. Deleted group pts. 8,122
  7. Avatar for Russian team 17. Russian team 1 pt. 7,944
  8. Avatar for freefolder 18. freefolder 1 pt. 7,616
  9. Avatar for Androids 19. Androids 1 pt. 7,265
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,698

  1. Avatar for lilovip 51. lilovip Lv 1 34 pts. 8,709
  2. Avatar for smholst 52. smholst Lv 1 33 pts. 8,707
  3. Avatar for Superphosphate 53. Superphosphate Lv 1 32 pts. 8,703
  4. Avatar for tallguy-13088 54. tallguy-13088 Lv 1 31 pts. 8,696
  5. Avatar for Threeoak 55. Threeoak Lv 1 30 pts. 8,694
  6. Avatar for crpainter 56. crpainter Lv 1 30 pts. 8,688
  7. Avatar for Glen B 57. Glen B Lv 1 29 pts. 8,684
  8. Avatar for isaksson 58. isaksson Lv 1 28 pts. 8,675
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 28 pts. 8,669
  10. Avatar for stomjoh 60. stomjoh Lv 1 27 pts. 8,668

Comments