Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,696
  1. Avatar for arginia 141. arginia Lv 1 2 pts. 7,731
  2. Avatar for martinf 142. martinf Lv 1 2 pts. 7,730
  3. Avatar for bamh 143. bamh Lv 1 2 pts. 7,728
  4. Avatar for pizpot 144. pizpot Lv 1 2 pts. 7,728
  5. Avatar for Andi1960 145. Andi1960 Lv 1 2 pts. 7,687
  6. Avatar for AgentGhost 146. AgentGhost Lv 1 2 pts. 7,677
  7. Avatar for bwkittitas 147. bwkittitas Lv 1 2 pts. 7,666
  8. Avatar for AryehK 148. AryehK Lv 1 2 pts. 7,657
  9. Avatar for pandabearsecond 149. pandabearsecond Lv 1 2 pts. 7,637
  10. Avatar for SouperGenious 150. SouperGenious Lv 1 2 pts. 7,635

Comments