Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,696
  1. Avatar for leeshanay 161. leeshanay Lv 1 1 pt. 7,494
  2. Avatar for romanus 162. romanus Lv 1 1 pt. 7,491
  3. Avatar for Sunet 163. Sunet Lv 1 1 pt. 7,461
  4. Avatar for student01 164. student01 Lv 1 1 pt. 7,460
  5. Avatar for Flagg65a 165. Flagg65a Lv 1 1 pt. 7,450
  6. Avatar for wozzarelli 166. wozzarelli Lv 1 1 pt. 7,447
  7. Avatar for andrewxc 167. andrewxc Lv 1 1 pt. 7,443
  8. Avatar for fishercat 168. fishercat Lv 1 1 pt. 7,433
  9. Avatar for FreeFolder 169. FreeFolder Lv 1 1 pt. 7,433
  10. Avatar for DScott 170. DScott Lv 1 1 pt. 7,422

Comments