Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,696
  1. Avatar for larry25427 221. larry25427 Lv 1 1 pt. 6,881
  2. Avatar for varjo1 222. varjo1 Lv 1 1 pt. 6,856
  3. Avatar for inkycatz 223. inkycatz Lv 1 1 pt. 6,831
  4. Avatar for may of rose 224. may of rose Lv 1 1 pt. 6,828
  5. Avatar for WWRS 225. WWRS Lv 1 1 pt. 6,818
  6. Avatar for cherry39 226. cherry39 Lv 1 1 pt. 6,798
  7. Avatar for BetaPleatedSheetsRock 227. BetaPleatedSheetsRock Lv 1 1 pt. 6,782
  8. Avatar for onzanzabarsands 228. onzanzabarsands Lv 1 1 pt. 6,778
  9. Avatar for antonio111 229. antonio111 Lv 1 1 pt. 6,760
  10. Avatar for Velproclet 230. Velproclet Lv 1 1 pt. 6,746

Comments