Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,696

  1. Avatar for IgorS 241. IgorS Lv 1 1 pt. 6,556
  2. Avatar for woseibonsu 242. woseibonsu Lv 1 1 pt. 6,529
  3. Avatar for Kevonni 243. Kevonni Lv 1 1 pt. 6,308
  4. Avatar for CJLOEFFLER 244. CJLOEFFLER Lv 1 1 pt. 6,302
  5. Avatar for bustchem 245. bustchem Lv 1 1 pt. 6,259
  6. Avatar for Bletchley Park 246. Bletchley Park Lv 1 1 pt. 6,222
  7. Avatar for Ellis Shih 247. Ellis Shih Lv 1 1 pt. 6,079
  8. Avatar for dflear 248. dflear Lv 1 1 pt. 6,018
  9. Avatar for brucederby 249. brucederby Lv 1 1 pt. 5,899
  10. Avatar for DennisLeo 250. DennisLeo Lv 1 1 pt. 4,816

Comments