Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685
  1. Avatar for egran48 21. egran48 Lv 1 3 pts. 9,052
  2. Avatar for gloverd 22. gloverd Lv 1 3 pts. 9,049
  3. Avatar for pauldunn 23. pauldunn Lv 1 2 pts. 9,048
  4. Avatar for packer 24. packer Lv 1 2 pts. 9,048
  5. Avatar for Paulo Roque 25. Paulo Roque Lv 1 1 pt. 9,047
  6. Avatar for mirp 26. mirp Lv 1 1 pt. 9,044
  7. Avatar for mimi 27. mimi Lv 1 1 pt. 9,041
  8. Avatar for Bruno Kestemont 28. Bruno Kestemont Lv 1 1 pt. 9,030
  9. Avatar for TomTaylor 29. TomTaylor Lv 1 1 pt. 9,025
  10. Avatar for sheerbliss 30. sheerbliss Lv 1 1 pt. 8,976

Comments