Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,823
  2. Avatar for Russian team 12. Russian team 2 pts. 8,609
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,539
  4. Avatar for xkcd 14. xkcd 1 pt. 8,521
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,493
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 7,898
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 7,827
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,550
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,198
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,652
  1. Avatar for v4mp1r3 171. v4mp1r3 Lv 1 1 pt. 7,348
  2. Avatar for mitarcher 172. mitarcher Lv 1 1 pt. 7,339
  3. Avatar for dlchan 173. dlchan Lv 1 1 pt. 7,334
  4. Avatar for ChanPete 174. ChanPete Lv 1 1 pt. 7,301
  5. Avatar for FadingMist 175. FadingMist Lv 1 1 pt. 7,295
  6. Avatar for inkycatz 176. inkycatz Lv 1 1 pt. 7,294
  7. Avatar for 01010011111 177. 01010011111 Lv 1 1 pt. 7,287
  8. Avatar for NotJim99 178. NotJim99 Lv 1 1 pt. 7,279
  9. Avatar for cnhrcolemam 179. cnhrcolemam Lv 1 1 pt. 7,272
  10. Avatar for pandabearsecond 180. pandabearsecond Lv 1 1 pt. 7,272

Comments