Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,823
  2. Avatar for Russian team 12. Russian team 2 pts. 8,609
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,539
  4. Avatar for xkcd 14. xkcd 1 pt. 8,521
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,493
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 7,898
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 7,827
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,550
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,198
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,652
  1. Avatar for Mrs_oo7o2 181. Mrs_oo7o2 Lv 1 1 pt. 7,255
  2. Avatar for momadoc 182. momadoc Lv 1 1 pt. 7,254
  3. Avatar for emdee314 183. emdee314 Lv 1 1 pt. 7,248
  4. Avatar for brgreening 184. brgreening Lv 1 1 pt. 7,241
  5. Avatar for SouperGenious 185. SouperGenious Lv 1 1 pt. 7,234
  6. Avatar for stefan.schmiedl 186. stefan.schmiedl Lv 1 1 pt. 7,213
  7. Avatar for wilding2004 187. wilding2004 Lv 1 1 pt. 7,198
  8. Avatar for Viz 188. Viz Lv 1 1 pt. 7,192
  9. Avatar for lilovip 189. lilovip Lv 1 1 pt. 7,182
  10. Avatar for Tac1 190. Tac1 Lv 1 1 pt. 7,180

Comments