Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,823
  2. Avatar for Russian team 12. Russian team 2 pts. 8,609
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,539
  4. Avatar for xkcd 14. xkcd 1 pt. 8,521
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,493
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 7,898
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 7,827
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,550
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,198
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,652
  1. Avatar for ivalnic 191. ivalnic Lv 1 1 pt. 7,179
  2. Avatar for cor2020 192. cor2020 Lv 1 1 pt. 7,171
  3. Avatar for Close At Hand 193. Close At Hand Lv 1 1 pt. 7,161
  4. Avatar for Inkedhands 194. Inkedhands Lv 1 1 pt. 7,157
  5. Avatar for gilofean 195. gilofean Lv 1 1 pt. 7,157
  6. Avatar for t012 196. t012 Lv 1 1 pt. 7,132
  7. Avatar for Firestorm4141 197. Firestorm4141 Lv 1 1 pt. 7,129
  8. Avatar for DemigodLuo 198. DemigodLuo Lv 1 1 pt. 7,128
  9. Avatar for Cruxon_Noctus 199. Cruxon_Noctus Lv 1 1 pt. 7,117
  10. Avatar for karost 200. karost Lv 1 1 pt. 7,111

Comments