Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for freefolder 21. freefolder 1 pt. 6,528
  1. Avatar for rezaefar 141. rezaefar Lv 1 2 pts. 7,844
  2. Avatar for lzhchild 142. lzhchild Lv 1 2 pts. 7,839
  3. Avatar for taminnugget 143. taminnugget Lv 1 2 pts. 7,828
  4. Avatar for Jajaboman 144. Jajaboman Lv 1 2 pts. 7,827
  5. Avatar for bwkittitas 145. bwkittitas Lv 1 2 pts. 7,818
  6. Avatar for haroshin 146. haroshin Lv 1 2 pts. 7,735
  7. Avatar for hada 147. hada Lv 1 2 pts. 7,730
  8. Avatar for hapalops 148. hapalops Lv 1 2 pts. 7,727
  9. Avatar for jebbiek 149. jebbiek Lv 1 2 pts. 7,720
  10. Avatar for varjo1 150. varjo1 Lv 1 2 pts. 7,713

Comments