Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for freefolder 21. freefolder 1 pt. 6,528
  1. Avatar for ViJay7019 151. ViJay7019 Lv 1 2 pts. 7,704
  2. Avatar for IHGreenman 152. IHGreenman Lv 1 1 pt. 7,702
  3. Avatar for tela 153. tela Lv 1 1 pt. 7,665
  4. Avatar for Iron pet 154. Iron pet Lv 1 1 pt. 7,630
  5. Avatar for proteansoup 155. proteansoup Lv 1 1 pt. 7,621
  6. Avatar for Thebatman012 156. Thebatman012 Lv 1 1 pt. 7,616
  7. Avatar for Thinlizard 157. Thinlizard Lv 1 1 pt. 7,604
  8. Avatar for lange 158. lange Lv 1 1 pt. 7,602
  9. Avatar for Ellis Shih 159. Ellis Shih Lv 1 1 pt. 7,599
  10. Avatar for gldisater 160. gldisater Lv 1 1 pt. 7,550

Comments