Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for freefolder 21. freefolder 1 pt. 6,528
  1. Avatar for franse 161. franse Lv 1 1 pt. 7,546
  2. Avatar for Simek 162. Simek Lv 1 1 pt. 7,489
  3. Avatar for lacie 163. lacie Lv 1 1 pt. 7,482
  4. Avatar for bamh 164. bamh Lv 1 1 pt. 7,481
  5. Avatar for FishKAA 165. FishKAA Lv 1 1 pt. 7,464
  6. Avatar for perrystaff 166. perrystaff Lv 1 1 pt. 7,418
  7. Avatar for seowhang 167. seowhang Lv 1 1 pt. 7,408
  8. Avatar for BetaPleatedSheetsRock 168. BetaPleatedSheetsRock Lv 1 1 pt. 7,390
  9. Avatar for Sunet 169. Sunet Lv 1 1 pt. 7,381
  10. Avatar for martinf 170. martinf Lv 1 1 pt. 7,362

Comments