Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for freefolder 21. freefolder 1 pt. 6,528

  1. Avatar for v4mp1r3 171. v4mp1r3 Lv 1 1 pt. 7,348
  2. Avatar for mitarcher 172. mitarcher Lv 1 1 pt. 7,339
  3. Avatar for dlchan 173. dlchan Lv 1 1 pt. 7,334
  4. Avatar for ChanPete 174. ChanPete Lv 1 1 pt. 7,301
  5. Avatar for FadingMist 175. FadingMist Lv 1 1 pt. 7,295
  6. Avatar for inkycatz 176. inkycatz Lv 1 1 pt. 7,294
  7. Avatar for 01010011111 177. 01010011111 Lv 1 1 pt. 7,287
  8. Avatar for NotJim99 178. NotJim99 Lv 1 1 pt. 7,279
  9. Avatar for cnhrcolemam 179. cnhrcolemam Lv 1 1 pt. 7,272
  10. Avatar for pandabearsecond 180. pandabearsecond Lv 1 1 pt. 7,272

Comments