Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for freefolder 21. freefolder 1 pt. 6,528
  1. Avatar for Mrs_oo7o2 181. Mrs_oo7o2 Lv 1 1 pt. 7,255
  2. Avatar for momadoc 182. momadoc Lv 1 1 pt. 7,254
  3. Avatar for emdee314 183. emdee314 Lv 1 1 pt. 7,248
  4. Avatar for brgreening 184. brgreening Lv 1 1 pt. 7,241
  5. Avatar for SouperGenious 185. SouperGenious Lv 1 1 pt. 7,234
  6. Avatar for stefan.schmiedl 186. stefan.schmiedl Lv 1 1 pt. 7,213
  7. Avatar for wilding2004 187. wilding2004 Lv 1 1 pt. 7,198
  8. Avatar for Viz 188. Viz Lv 1 1 pt. 7,192
  9. Avatar for lilovip 189. lilovip Lv 1 1 pt. 7,182
  10. Avatar for Tac1 190. Tac1 Lv 1 1 pt. 7,180

Comments