Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for freefolder 21. freefolder 1 pt. 6,528
  1. Avatar for ivalnic 191. ivalnic Lv 1 1 pt. 7,179
  2. Avatar for cor2020 192. cor2020 Lv 1 1 pt. 7,171
  3. Avatar for Close At Hand 193. Close At Hand Lv 1 1 pt. 7,161
  4. Avatar for Inkedhands 194. Inkedhands Lv 1 1 pt. 7,157
  5. Avatar for gilofean 195. gilofean Lv 1 1 pt. 7,157
  6. Avatar for t012 196. t012 Lv 1 1 pt. 7,132
  7. Avatar for Firestorm4141 197. Firestorm4141 Lv 1 1 pt. 7,129
  8. Avatar for DemigodLuo 198. DemigodLuo Lv 1 1 pt. 7,128
  9. Avatar for Cruxon_Noctus 199. Cruxon_Noctus Lv 1 1 pt. 7,117
  10. Avatar for karost 200. karost Lv 1 1 pt. 7,111

Comments