Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for gloverd 11. gloverd Lv 1 25 pts. 9,311
  2. Avatar for Galaxie 12. Galaxie Lv 1 21 pts. 9,310
  3. Avatar for Paulo Roque 13. Paulo Roque Lv 1 18 pts. 9,309
  4. Avatar for mirp 14. mirp Lv 1 15 pts. 9,307
  5. Avatar for DodoBird 15. DodoBird Lv 1 13 pts. 9,305
  6. Avatar for sheerbliss 16. sheerbliss Lv 1 11 pts. 9,305
  7. Avatar for packer 17. packer Lv 1 9 pts. 9,303
  8. Avatar for TomTaylor 18. TomTaylor Lv 1 7 pts. 9,275
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 6 pts. 9,275
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 5 pts. 9,262

Comments