Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,450
  2. Avatar for bertro 2. bertro Lv 1 99 pts. 9,416
  3. Avatar for Deleted player 3. Deleted player pts. 9,401
  4. Avatar for johnmitch 4. johnmitch Lv 1 95 pts. 9,322
  5. Avatar for mirp 5. mirp Lv 1 93 pts. 9,310
  6. Avatar for KarenCH 6. KarenCH Lv 1 91 pts. 9,309
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 89 pts. 9,278
  8. Avatar for dembones 8. dembones Lv 1 87 pts. 9,275
  9. Avatar for frood66 9. frood66 Lv 1 85 pts. 9,265
  10. Avatar for smilingone 10. smilingone Lv 1 84 pts. 9,263

Comments