Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for GenGF 111. GenGF Lv 1 6 pts. 8,301
  2. Avatar for phi16 112. phi16 Lv 1 6 pts. 8,298
  3. Avatar for Merf 113. Merf Lv 1 6 pts. 8,274
  4. Avatar for WBarme1234 114. WBarme1234 Lv 1 5 pts. 8,239
  5. Avatar for weitzen 115. weitzen Lv 1 5 pts. 8,190
  6. Avatar for Punktchen 116. Punktchen Lv 1 5 pts. 8,188
  7. Avatar for pmthomson90 117. pmthomson90 Lv 1 5 pts. 8,184
  8. Avatar for dettingen 118. dettingen Lv 1 5 pts. 8,154
  9. Avatar for sharondipity 119. sharondipity Lv 1 5 pts. 8,151
  10. Avatar for ncameron 120. ncameron Lv 1 4 pts. 8,126

Comments