1116: Revisiting Puzzle 83: Cardiotoxin
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- July 21, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
