1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Summary

• Created: July 21, 2015
• Expires: July 28, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

• 1. Beta Folders 100 pts. 9,494
• 2. Go Science 78 pts. 9,312
• 3. Anthropic Dreams 60 pts. 9,310
• 4. Contenders 45 pts. 9,275
• 5. Gargleblasters 33 pts. 9,265
• 6. Deleted group pts. 9,209
• 7. Void Crushers 17 pts. 9,196
• 8. HMT heritage 12 pts. 9,169
• 9. L'Alliance Francophone 8 pts. 9,166
• 10. Deleted group pts. 8,865

Top soloists

• 31. nicobul 53 pts. 9,090
• 32. Skippysk8s 52 pts. 9,080
• 33. mimi 51 pts. 9,059
• 34. Blipperman 50 pts. 9,058
• 35. dcrwheeler 49 pts. 9,057
• 36. g_b 48 pts. 9,045
• 37. uhuuhu 46 pts. 9,033
• 38. jamiexq 45 pts. 9,012
• 39. christioanchauvin 44 pts. 9,010
• 40. gurra66 43 pts. 8,998