Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 6 pts. 8,907
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 8,621
  3. Avatar for Russian team 13. Russian team 3 pts. 8,311
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,306
  5. Avatar for freefolder 15. freefolder 1 pt. 8,297
  6. Avatar for xkcd 16. xkcd 1 pt. 8,231
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,203
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 8,058
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,822
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,695
  1. Avatar for mitarcher 141. mitarcher Lv 1 2 pts. 7,915
  2. Avatar for Iron pet 142. Iron pet Lv 1 2 pts. 7,902
  3. Avatar for SouperGenious 143. SouperGenious Lv 1 2 pts. 7,874
  4. Avatar for Jean-Bob 144. Jean-Bob Lv 1 2 pts. 7,867
  5. Avatar for tertyshnik.v 145. tertyshnik.v Lv 1 2 pts. 7,860
  6. Avatar for JeNNeR 146. JeNNeR Lv 1 2 pts. 7,822
  7. Avatar for Datstandin 147. Datstandin Lv 1 2 pts. 7,785
  8. Avatar for taminnugget 148. taminnugget Lv 1 2 pts. 7,783
  9. Avatar for martinf 149. martinf Lv 1 2 pts. 7,767
  10. Avatar for tela 150. tela Lv 1 1 pt. 7,766

Comments