Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 6 pts. 8,907
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 8,621
  3. Avatar for Russian team 13. Russian team 3 pts. 8,311
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,306
  5. Avatar for freefolder 15. freefolder 1 pt. 8,297
  6. Avatar for xkcd 16. xkcd 1 pt. 8,231
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,203
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 8,058
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,822
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,695
  1. Avatar for akihoklaus 221. akihoklaus Lv 1 1 pt. 6,820
  2. Avatar for hpaege 222. hpaege Lv 1 1 pt. 6,668
  3. Avatar for multaq 223. multaq Lv 1 1 pt. 6,659
  4. Avatar for MZ123 224. MZ123 Lv 1 1 pt. 6,641
  5. Avatar for 16637054_Lerm 225. 16637054_Lerm Lv 1 1 pt. 6,640
  6. Avatar for wozzarelli 226. wozzarelli Lv 1 1 pt. 6,599
  7. Avatar for Ronin-Sensei 227. Ronin-Sensei Lv 1 1 pt. 6,536
  8. Avatar for paerns 228. paerns Lv 1 1 pt. 6,529
  9. Avatar for rout 229. rout Lv 1 1 pt. 6,514
  10. Avatar for Wondry 230. Wondry Lv 1 1 pt. 6,385

Comments