Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 6 pts. 8,907
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 8,621
  3. Avatar for Russian team 13. Russian team 3 pts. 8,311
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,306
  5. Avatar for freefolder 15. freefolder 1 pt. 8,297
  6. Avatar for xkcd 16. xkcd 1 pt. 8,231
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,203
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 8,058
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,822
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,695

  1. Avatar for brow42 51. brow42 Lv 1 33 pts. 8,958
  2. Avatar for Museka 52. Museka Lv 1 32 pts. 8,952
  3. Avatar for greepski 53. greepski Lv 1 31 pts. 8,947
  4. Avatar for nemo7731 54. nemo7731 Lv 1 30 pts. 8,945
  5. Avatar for caglar 55. caglar Lv 1 30 pts. 8,944
  6. Avatar for jdormaar 56. jdormaar Lv 1 29 pts. 8,907
  7. Avatar for crpainter 57. crpainter Lv 1 28 pts. 8,906
  8. Avatar for O Seki To 58. O Seki To Lv 1 27 pts. 8,889
  9. Avatar for shettler 59. shettler Lv 1 27 pts. 8,886
  10. Avatar for johngran 60. johngran Lv 1 26 pts. 8,875

Comments