Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370

  1. Avatar for viosca
    1. viosca Lv 1
    100 pts. 9,236
  2. Avatar for g_b 2. g_b Lv 1 98 pts. 9,219
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 97 pts. 9,182
  4. Avatar for nicobul 4. nicobul Lv 1 95 pts. 9,180
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 93 pts. 9,178
  6. Avatar for egran48 6. egran48 Lv 1 91 pts. 9,177
  7. Avatar for dembones 7. dembones Lv 1 89 pts. 9,176
  8. Avatar for jeff101 8. jeff101 Lv 1 87 pts. 9,173
  9. Avatar for Blipperman 9. Blipperman Lv 1 85 pts. 9,164
  10. Avatar for frood66 10. frood66 Lv 1 84 pts. 9,163

Comments