Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,236
  2. Avatar for Go Science 2. Go Science 81 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,187
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 9,180
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,180
  6. Avatar for Contenders 6. Contenders 30 pts. 9,178
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,115
  8. Avatar for Deleted group 8. Deleted group pts. 9,093
  9. Avatar for Deleted group 9. Deleted group pts. 9,052
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,907

  1. Avatar for phi16 41. phi16 Lv 1 1 pt. 9,010
  2. Avatar for O Seki To 42. O Seki To Lv 1 1 pt. 8,907
  3. Avatar for Ashrai 43. Ashrai Lv 1 1 pt. 8,848
  4. Avatar for dembones 44. dembones Lv 1 1 pt. 8,598
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 1 pt. 8,003
  6. Avatar for harvardman 46. harvardman Lv 1 1 pt. 7,378
  7. Avatar for Datstandin 47. Datstandin Lv 1 1 pt. 7,051
  8. Avatar for ponderosa 48. ponderosa Lv 1 1 pt. 3,370

Comments