Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,236
  2. Avatar for Go Science 2. Go Science 81 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,187
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 9,180
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,180
  6. Avatar for Contenders 6. Contenders 30 pts. 9,178
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,115
  8. Avatar for Deleted group 8. Deleted group pts. 9,093
  9. Avatar for Deleted group 9. Deleted group pts. 9,052
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,907
  1. Avatar for whartonbj 191. whartonbj Lv 1 1 pt. 7,302
  2. Avatar for Philippe_C 192. Philippe_C Lv 1 1 pt. 7,301
  3. Avatar for polly66017 193. polly66017 Lv 1 1 pt. 7,298
  4. Avatar for apklock 194. apklock Lv 1 1 pt. 7,289
  5. Avatar for volantta 195. volantta Lv 1 1 pt. 7,288
  6. Avatar for lilovip 196. lilovip Lv 1 1 pt. 7,280
  7. Avatar for ricdelp 197. ricdelp Lv 1 1 pt. 7,279
  8. Avatar for varjo1 198. varjo1 Lv 1 1 pt. 7,272
  9. Avatar for momadoc 199. momadoc Lv 1 1 pt. 7,237
  10. Avatar for Miguel F 200. Miguel F Lv 1 1 pt. 7,227

Comments