Placeholder image of a protein
Icon representing a puzzle

1120: Unsolved De-novo Freestyle 54

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 30, 2015
Expires
Max points
100
Description

The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNA

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 8,327
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,289
  4. Avatar for Deleted group 14. Deleted group pts. 8,240
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,043
  6. Avatar for freefolder 16. freefolder 1 pt. 7,815
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,810
  8. Avatar for foldeRNA 18. foldeRNA 1 pt. 7,116
  9. Avatar for Jorks! 19. Jorks! 1 pt. 6,652
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,067

  1. Avatar for NotJim99 121. NotJim99 Lv 1 5 pts. 7,630
  2. Avatar for Superphosphate 122. Superphosphate Lv 1 5 pts. 7,573
  3. Avatar for lange 123. lange Lv 1 4 pts. 7,489
  4. Avatar for Lalourche 124. Lalourche Lv 1 4 pts. 7,474
  5. Avatar for firsov 125. firsov Lv 1 4 pts. 7,453
  6. Avatar for pfirth 126. pfirth Lv 1 4 pts. 7,449
  7. Avatar for inkycatz 127. inkycatz Lv 1 4 pts. 7,426
  8. Avatar for poiuyqwert 128. poiuyqwert Lv 1 4 pts. 7,419
  9. Avatar for sharondipity 129. sharondipity Lv 1 4 pts. 7,392
  10. Avatar for parsnip 130. parsnip Lv 1 3 pts. 7,386

Comments


brgreening Lv 1

the display of the
Simplified version of the Jpred4 SS prediction
above was as a JPG file. Could you display it
as plain text? That way, a player could copy the
text string an put it in a "set the amino acids"
program?

Madde Lv 1

1———11——–21——–31——–41——–51——–61——–71——–81——–91——–101——-111——-121——-131——- MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNA CCCCcHHHHHHHHHHHHHHHHHHhhcchhccCCCccHHHHHHHHHHHHHHHHHHhccCCCCchHHHHHHHHHHHhhhcceeecCcceechhhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHhHHHHHHHccCCC 99972799999999999999999200111047776378999999999999999812688876278999999987330212231763210130358999999999874201589999999999999885899998715999

bkoep Staff Lv 1

These secondary structure predictions are probably more accurate than those provided on the starting solution. It seems there was a problem with our original PSIPRED predictions for this sequence.

Thanks Madde!

Bautho Lv 1

Maybe too late, but the OCTOPUS server predicted this protein to be a membrane protein…
You should maybe add this into the description.

Sequence name: query_sequence
Sequence length: 140 aa.
Sequence:
MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSS
PTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGT
IVAVHLLGRPLGRLVDRDNA

SPOCTOPUS predicted topology:
ooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiMMMMMMMMMMMMMMMMMMMMMoooooo
ooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiMMMMMMMMMMMMMMMoMMMMMMMMMM
MMMMMiiiiiiiiiiiiiii