Placeholder image of a protein
Icon representing a puzzle

1120: Unsolved De-novo Freestyle 54

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 30, 2015
Expires
Max points
100
Description

The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNA

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 8,327
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,289
  4. Avatar for Deleted group 14. Deleted group pts. 8,240
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,043
  6. Avatar for freefolder 16. freefolder 1 pt. 7,815
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,810
  8. Avatar for foldeRNA 18. foldeRNA 1 pt. 7,116
  9. Avatar for Jorks! 19. Jorks! 1 pt. 6,652
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,067

  1. Avatar for SouperGenious 131. SouperGenious Lv 1 3 pts. 7,379
  2. Avatar for IHGreenman 132. IHGreenman Lv 1 3 pts. 7,319
  3. Avatar for hitmandan 133. hitmandan Lv 1 3 pts. 7,315
  4. Avatar for mirjamvandelft 134. mirjamvandelft Lv 1 3 pts. 7,302
  5. Avatar for inskino37 135. inskino37 Lv 1 3 pts. 7,294
  6. Avatar for cnhrcolemam 136. cnhrcolemam Lv 1 3 pts. 7,270
  7. Avatar for Slippy 137. Slippy Lv 1 3 pts. 7,229
  8. Avatar for Inkedhands 138. Inkedhands Lv 1 3 pts. 7,223
  9. Avatar for dbuske 139. dbuske Lv 1 3 pts. 7,220
  10. Avatar for Arne Heessels 140. Arne Heessels Lv 1 2 pts. 7,159

Comments


brgreening Lv 1

the display of the
Simplified version of the Jpred4 SS prediction
above was as a JPG file. Could you display it
as plain text? That way, a player could copy the
text string an put it in a "set the amino acids"
program?

Madde Lv 1

1———11——–21——–31——–41——–51——–61——–71——–81——–91——–101——-111——-121——-131——- MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNA CCCCcHHHHHHHHHHHHHHHHHHhhcchhccCCCccHHHHHHHHHHHHHHHHHHhccCCCCchHHHHHHHHHHHhhhcceeecCcceechhhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHhHHHHHHHccCCC 99972799999999999999999200111047776378999999999999999812688876278999999987330212231763210130358999999999874201589999999999999885899998715999

bkoep Staff Lv 1

These secondary structure predictions are probably more accurate than those provided on the starting solution. It seems there was a problem with our original PSIPRED predictions for this sequence.

Thanks Madde!

Bautho Lv 1

Maybe too late, but the OCTOPUS server predicted this protein to be a membrane protein…
You should maybe add this into the description.

Sequence name: query_sequence
Sequence length: 140 aa.
Sequence:
MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSS
PTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGT
IVAVHLLGRPLGRLVDRDNA

SPOCTOPUS predicted topology:
ooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiMMMMMMMMMMMMMMMMMMMMMoooooo
ooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiMMMMMMMMMMMMMMMoMMMMMMMMMM
MMMMMiiiiiiiiiiiiiii