Placeholder image of a protein
Icon representing a puzzle

1120: Unsolved De-novo Freestyle 54

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 30, 2015
Expires
Max points
100
Description

The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNA

Top groups


  1. Avatar for Void Crushers 100 pts. 9,545
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,392
  3. Avatar for Go Science 3. Go Science 61 pts. 9,376
  4. Avatar for Contenders 4. Contenders 47 pts. 9,321
  5. Avatar for Beta Folders 5. Beta Folders 35 pts. 9,296
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,208
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,047
  9. Avatar for Deleted group 9. Deleted group pts. 8,834
  10. Avatar for xkcd 10. xkcd 7 pts. 8,507

  1. Avatar for Andi1960 101. Andi1960 Lv 1 9 pts. 7,971
  2. Avatar for ecali 102. ecali Lv 1 9 pts. 7,950
  3. Avatar for ppp6 103. ppp6 Lv 1 8 pts. 7,918
  4. Avatar for Merf 104. Merf Lv 1 8 pts. 7,916
  5. Avatar for abiogenesis 105. abiogenesis Lv 1 8 pts. 7,913
  6. Avatar for DodoBird 106. DodoBird Lv 1 8 pts. 7,882
  7. Avatar for Jim Fraser 107. Jim Fraser Lv 1 7 pts. 7,844
  8. Avatar for pfeiffelfloyd 108. pfeiffelfloyd Lv 1 7 pts. 7,842
  9. Avatar for Punktchen 109. Punktchen Lv 1 7 pts. 7,829
  10. Avatar for Flagg65a 110. Flagg65a Lv 1 7 pts. 7,827

Comments


brgreening Lv 1

the display of the
Simplified version of the Jpred4 SS prediction
above was as a JPG file. Could you display it
as plain text? That way, a player could copy the
text string an put it in a "set the amino acids"
program?

Madde Lv 1

1———11——–21——–31——–41——–51——–61——–71——–81——–91——–101——-111——-121——-131——- MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNA CCCCcHHHHHHHHHHHHHHHHHHhhcchhccCCCccHHHHHHHHHHHHHHHHHHhccCCCCchHHHHHHHHHHHhhhcceeecCcceechhhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHhHHHHHHHccCCC 99972799999999999999999200111047776378999999999999999812688876278999999987330212231763210130358999999999874201589999999999999885899998715999

bkoep Staff Lv 1

These secondary structure predictions are probably more accurate than those provided on the starting solution. It seems there was a problem with our original PSIPRED predictions for this sequence.

Thanks Madde!

Bautho Lv 1

Maybe too late, but the OCTOPUS server predicted this protein to be a membrane protein…
You should maybe add this into the description.

Sequence name: query_sequence
Sequence length: 140 aa.
Sequence:
MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSS
PTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGT
IVAVHLLGRPLGRLVDRDNA

SPOCTOPUS predicted topology:
ooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiMMMMMMMMMMMMMMMMMMMMMoooooo
ooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiMMMMMMMMMMMMMMMoMMMMMMMMMM
MMMMMiiiiiiiiiiiiiii