Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,952
  2. Avatar for Blipperman 2. Blipperman Lv 1 98 pts. 9,930
  3. Avatar for frood66 3. frood66 Lv 1 96 pts. 9,912
  4. Avatar for Galaxie 4. Galaxie Lv 1 94 pts. 9,907
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 92 pts. 9,899
  6. Avatar for gmn 6. gmn Lv 1 90 pts. 9,890
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 89 pts. 9,888
  8. Avatar for dembones 8. dembones Lv 1 87 pts. 9,884
  9. Avatar for mirp 9. mirp Lv 1 85 pts. 9,840
  10. Avatar for viosca 10. viosca Lv 1 83 pts. 9,838

Comments