Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283

  1. Avatar for gloverd
    1. gloverd Lv 1
    100 pts. 10,031
  2. Avatar for Paulo Roque 2. Paulo Roque Lv 1 89 pts. 10,028
  3. Avatar for mirp 3. mirp Lv 1 79 pts. 10,028
  4. Avatar for egran48 4. egran48 Lv 1 70 pts. 10,025
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 61 pts. 10,024
  6. Avatar for Blipperman 6. Blipperman Lv 1 54 pts. 9,983
  7. Avatar for actiasluna 7. actiasluna Lv 1 47 pts. 9,981
  8. Avatar for andrewxc 8. andrewxc Lv 1 41 pts. 9,966
  9. Avatar for greepski 9. greepski Lv 1 35 pts. 9,959
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 30 pts. 9,956

Comments