Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283

  1. Avatar for abiogenesis 121. abiogenesis Lv 1 4 pts. 8,132
  2. Avatar for Jim Fraser 122. Jim Fraser Lv 1 3 pts. 8,122
  3. Avatar for Deleted player 123. Deleted player pts. 8,084
  4. Avatar for gurra66 124. gurra66 Lv 1 3 pts. 8,083
  5. Avatar for 01010011111 125. 01010011111 Lv 1 3 pts. 8,059
  6. Avatar for goldfish80 126. goldfish80 Lv 1 3 pts. 8,053
  7. Avatar for fishercat 127. fishercat Lv 1 3 pts. 8,051
  8. Avatar for leehaggis 128. leehaggis Lv 1 3 pts. 8,018
  9. Avatar for arginia 129. arginia Lv 1 3 pts. 7,920
  10. Avatar for NR22 130. NR22 Lv 1 3 pts. 7,920

Comments