Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283

  1. Avatar for Kren 201. Kren Lv 1 1 pt. 6,780
  2. Avatar for Ayaya_ 202. Ayaya_ Lv 1 1 pt. 6,772
  3. Avatar for smarthuman 203. smarthuman Lv 1 1 pt. 6,771
  4. Avatar for JackONeill12 204. JackONeill12 Lv 1 1 pt. 6,770
  5. Avatar for wozzarelli 205. wozzarelli Lv 1 1 pt. 6,765
  6. Avatar for eye 206. eye Lv 1 1 pt. 6,753
  7. Avatar for lucachersoni 207. lucachersoni Lv 1 1 pt. 6,736
  8. Avatar for jonesebe 208. jonesebe Lv 1 1 pt. 6,716
  9. Avatar for pie1337 209. pie1337 Lv 1 1 pt. 6,706
  10. Avatar for iwancoppa 210. iwancoppa Lv 1 1 pt. 6,701

Comments