Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,424
  2. Avatar for Deleted group 12. Deleted group pts. 8,321
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,264
  4. Avatar for freefolder 14. freefolder 1 pt. 8,222
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,123
  6. Avatar for xkcd 16. xkcd 1 pt. 8,106
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,693
  8. Avatar for CureCoin 18. CureCoin 1 pt. 5,442
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,101
  10. Avatar for DCC Folders 20. DCC Folders 1 pt. 0
  1. Avatar for wcl294 151. wcl294 Lv 1 1 pt. 7,549
  2. Avatar for mustapha707 152. mustapha707 Lv 1 1 pt. 7,535
  3. Avatar for inkycatz 153. inkycatz Lv 1 1 pt. 7,504
  4. Avatar for cnhrcolemam 154. cnhrcolemam Lv 1 1 pt. 7,501
  5. Avatar for parsnip 155. parsnip Lv 1 1 pt. 7,489
  6. Avatar for zeropourcent 156. zeropourcent Lv 1 1 pt. 7,480
  7. Avatar for momadoc 157. momadoc Lv 1 1 pt. 7,472
  8. Avatar for ande.elliott 158. ande.elliott Lv 1 1 pt. 7,442
  9. Avatar for Veqqwximr 159. Veqqwximr Lv 1 1 pt. 7,435
  10. Avatar for ruiabg 160. ruiabg Lv 1 1 pt. 7,346

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.