Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for gmn 11. gmn Lv 1 30 pts. 8,805
  2. Avatar for MaartenDesnouck 12. MaartenDesnouck Lv 1 26 pts. 8,805
  3. Avatar for jamiexq 13. jamiexq Lv 1 23 pts. 8,805
  4. Avatar for lamoille 14. lamoille Lv 1 20 pts. 8,801
  5. Avatar for Lindata 15. Lindata Lv 1 17 pts. 8,800
  6. Avatar for alwen 16. alwen Lv 1 14 pts. 8,795
  7. Avatar for gdnskye 17. gdnskye Lv 1 12 pts. 8,794
  8. Avatar for DodoBird 18. DodoBird Lv 1 10 pts. 8,794
  9. Avatar for 01010011111 19. 01010011111 Lv 1 9 pts. 8,770
  10. Avatar for pauldunn 20. pauldunn Lv 1 7 pts. 8,764

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.