Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,226
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 8,067
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,037
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 2 pts. 8,027
  5. Avatar for xkcd 15. xkcd 1 pt. 7,906
  6. Avatar for foldeRNA 16. foldeRNA 1 pt. 7,897
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,518
  8. Avatar for Team China 18. Team China 1 pt. 7,350
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,332
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,082

  1. Avatar for Blipperman
    1. Blipperman Lv 1
    100 pts. 8,384
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 90 pts. 8,383
  3. Avatar for Galaxie 3. Galaxie Lv 1 80 pts. 8,379
  4. Avatar for dbuske 4. dbuske Lv 1 71 pts. 8,374
  5. Avatar for actiasluna 5. actiasluna Lv 1 63 pts. 8,372
  6. Avatar for frood66 6. frood66 Lv 1 56 pts. 8,369
  7. Avatar for MaartenDesnouck 7. MaartenDesnouck Lv 1 49 pts. 8,369
  8. Avatar for gloverd 8. gloverd Lv 1 43 pts. 8,365
  9. Avatar for Paulo Roque 9. Paulo Roque Lv 1 38 pts. 8,364
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 33 pts. 8,364

Comments