Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,226
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 8,067
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,037
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 2 pts. 8,027
  5. Avatar for xkcd 15. xkcd 1 pt. 7,906
  6. Avatar for foldeRNA 16. foldeRNA 1 pt. 7,897
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,518
  8. Avatar for Team China 18. Team China 1 pt. 7,350
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,332
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,082
  1. Avatar for mitarcher 131. mitarcher Lv 1 2 pts. 7,827
  2. Avatar for Deleted player 132. Deleted player pts. 7,821
  3. Avatar for Idiotboy 133. Idiotboy Lv 1 2 pts. 7,817
  4. Avatar for data00 134. data00 Lv 1 2 pts. 7,787
  5. Avatar for Ofelya 135. Ofelya Lv 1 2 pts. 7,772
  6. Avatar for drumpeter18yrs9yrs 136. drumpeter18yrs9yrs Lv 1 2 pts. 7,763
  7. Avatar for Truncheon Luncheon 137. Truncheon Luncheon Lv 1 2 pts. 7,762
  8. Avatar for TJOK fan 138. TJOK fan Lv 1 2 pts. 7,760
  9. Avatar for Ernst Zundel 139. Ernst Zundel Lv 1 2 pts. 7,759
  10. Avatar for Festering Wounds 140. Festering Wounds Lv 1 2 pts. 7,756

Comments