Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,226
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 8,067
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,037
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 2 pts. 8,027
  5. Avatar for xkcd 15. xkcd 1 pt. 7,906
  6. Avatar for foldeRNA 16. foldeRNA 1 pt. 7,897
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,518
  8. Avatar for Team China 18. Team China 1 pt. 7,350
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,332
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,082
  1. Avatar for Andi1960 161. Andi1960 Lv 1 1 pt. 7,600
  2. Avatar for s5012831 162. s5012831 Lv 1 1 pt. 7,594
  3. Avatar for Mydogisa Toelicker 163. Mydogisa Toelicker Lv 1 1 pt. 7,582
  4. Avatar for cor2020 164. cor2020 Lv 1 1 pt. 7,579
  5. Avatar for jseckler 165. jseckler Lv 1 1 pt. 7,561
  6. Avatar for poiuyqwert 166. poiuyqwert Lv 1 1 pt. 7,557
  7. Avatar for NameChangeNeeded01 167. NameChangeNeeded01 Lv 1 1 pt. 7,538
  8. Avatar for taminnugget 168. taminnugget Lv 1 1 pt. 7,534
  9. Avatar for val.sch67 169. val.sch67 Lv 1 1 pt. 7,533
  10. Avatar for Bazror 170. Bazror Lv 1 1 pt. 7,519

Comments