Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,226
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 8,067
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,037
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 2 pts. 8,027
  5. Avatar for xkcd 15. xkcd 1 pt. 7,906
  6. Avatar for foldeRNA 16. foldeRNA 1 pt. 7,897
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,518
  8. Avatar for Team China 18. Team China 1 pt. 7,350
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,332
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,082

  1. Avatar for johnmitch 31. johnmitch Lv 1 51 pts. 8,273
  2. Avatar for Galaxie 32. Galaxie Lv 1 50 pts. 8,269
  3. Avatar for Merf 33. Merf Lv 1 49 pts. 8,267
  4. Avatar for sheerbliss 34. sheerbliss Lv 1 48 pts. 8,247
  5. Avatar for nemo7731 35. nemo7731 Lv 1 47 pts. 8,237
  6. Avatar for Imeturoran 36. Imeturoran Lv 1 46 pts. 8,237
  7. Avatar for matosfran 37. matosfran Lv 1 45 pts. 8,233
  8. Avatar for RockOn 38. RockOn Lv 1 43 pts. 8,230
  9. Avatar for mimi 39. mimi Lv 1 42 pts. 8,227
  10. Avatar for Amphimixus 40. Amphimixus Lv 1 41 pts. 8,226

Comments