Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 7,042
  2. Avatar for Boinc.be 22. Boinc.be 1 pt. 6,950
  3. Avatar for Russian team 23. Russian team 1 pt. 4,800

  1. Avatar for demeter900 181. demeter900 Lv 1 1 pt. 7,351
  2. Avatar for wintry 182. wintry Lv 1 1 pt. 7,350
  3. Avatar for Gojira 183. Gojira Lv 1 1 pt. 7,350
  4. Avatar for wilding2004 184. wilding2004 Lv 1 1 pt. 7,332
  5. Avatar for Anairam 186. Anairam Lv 1 1 pt. 7,298
  6. Avatar for franse 187. franse Lv 1 1 pt. 7,296
  7. Avatar for GreekCivilization 188. GreekCivilization Lv 1 1 pt. 7,280
  8. Avatar for FreeFolder 189. FreeFolder Lv 1 1 pt. 7,258
  9. Avatar for Close At Hand 190. Close At Hand Lv 1 1 pt. 7,249

Comments