Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 7,042
  2. Avatar for Boinc.be 22. Boinc.be 1 pt. 6,950
  3. Avatar for Russian team 23. Russian team 1 pt. 4,800

  1. Avatar for karost 191. karost Lv 1 1 pt. 7,239
  2. Avatar for wozzarelli 192. wozzarelli Lv 1 1 pt. 7,219
  3. Avatar for lolmaster22 193. lolmaster22 Lv 1 1 pt. 7,208
  4. Avatar for wurzelwicht 194. wurzelwicht Lv 1 1 pt. 7,207
  5. Avatar for calgone 195. calgone Lv 1 1 pt. 7,198
  6. Avatar for lamoille 196. lamoille Lv 1 1 pt. 7,192
  7. Avatar for perrystaff 197. perrystaff Lv 1 1 pt. 7,187
  8. Avatar for dmiller13 198. dmiller13 Lv 1 1 pt. 7,169
  9. Avatar for Jordanisnotmyname 199. Jordanisnotmyname Lv 1 1 pt. 7,158
  10. Avatar for dieterdb 200. dieterdb Lv 1 1 pt. 7,151

Comments