Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 7,042
  2. Avatar for Boinc.be 22. Boinc.be 1 pt. 6,950
  3. Avatar for Russian team 23. Russian team 1 pt. 4,800

  1. Avatar for benzene11 211. benzene11 Lv 1 1 pt. 6,904
  2. Avatar for frankgu968 212. frankgu968 Lv 1 1 pt. 6,896
  3. Avatar for Kelly Barnett 213. Kelly Barnett Lv 1 1 pt. 6,893
  4. Avatar for smarthuman 214. smarthuman Lv 1 1 pt. 6,875
  5. Avatar for maskboy 215. maskboy Lv 1 1 pt. 6,873
  6. Avatar for tymaja 216. tymaja Lv 1 1 pt. 6,835
  7. Avatar for zkm 217. zkm Lv 1 1 pt. 6,740
  8. Avatar for trentis1 218. trentis1 Lv 1 1 pt. 6,685
  9. Avatar for Mefisthus 219. Mefisthus Lv 1 1 pt. 6,642
  10. Avatar for inkycatz 220. inkycatz Lv 1 1 pt. 6,641

Comments