Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 7,042
  2. Avatar for Boinc.be 22. Boinc.be 1 pt. 6,950
  3. Avatar for Russian team 23. Russian team 1 pt. 4,800

  1. Avatar for d841116 221. d841116 Lv 1 1 pt. 6,589
  2. Avatar for lazulite 222. lazulite Lv 1 1 pt. 6,423
  3. Avatar for st.kawari 223. st.kawari Lv 1 1 pt. 6,353
  4. Avatar for Lunchboxicus 224. Lunchboxicus Lv 1 1 pt. 6,180
  5. Avatar for Deleted player 225. Deleted player pts. 5,459
  6. Avatar for guigodss 226. guigodss Lv 1 1 pt. 5,459
  7. Avatar for Abraxas0815 227. Abraxas0815 Lv 1 1 pt. 4,859
  8. Avatar for dhenline 228. dhenline Lv 1 1 pt. 4,804
  9. Avatar for bkoep 229. bkoep Lv 1 1 pt. 4,800
  10. Avatar for alcor29 230. alcor29 Lv 1 1 pt. 4,800

Comments