Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Gargleblasters 100 pts. 8,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 8,383
  3. Avatar for Go Science 3. Go Science 63 pts. 8,365
  4. Avatar for Contenders 4. Contenders 49 pts. 8,361
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 8,361
  6. Avatar for Beta Folders 6. Beta Folders 28 pts. 8,332
  7. Avatar for Deleted group 7. Deleted group pts. 8,325
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 8,318
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,291
  10. Avatar for freefolder 10. freefolder 8 pts. 8,237

  1. Avatar for Sissue 31. Sissue Lv 1 1 pt. 8,308
  2. Avatar for gdnskye 32. gdnskye Lv 1 1 pt. 8,287
  3. Avatar for lamoille 33. lamoille Lv 1 1 pt. 8,286
  4. Avatar for alwen 34. alwen Lv 1 1 pt. 8,286
  5. Avatar for phi16 35. phi16 Lv 1 1 pt. 8,286
  6. Avatar for gmn 36. gmn Lv 1 1 pt. 8,286
  7. Avatar for Lindata 37. Lindata Lv 1 1 pt. 8,286
  8. Avatar for 01010011111 38. 01010011111 Lv 1 1 pt. 8,281
  9. Avatar for DodoBird 39. DodoBird Lv 1 1 pt. 8,277
  10. Avatar for andrewxc 40. andrewxc Lv 1 1 pt. 8,260

Comments