Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 8,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 8,383
  3. Avatar for Go Science 3. Go Science 63 pts. 8,365
  4. Avatar for Contenders 4. Contenders 49 pts. 8,361
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 8,361
  6. Avatar for Beta Folders 6. Beta Folders 28 pts. 8,332
  7. Avatar for Deleted group 7. Deleted group pts. 8,325
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 8,318
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,291
  10. Avatar for freefolder 10. freefolder 8 pts. 8,237
  1. Avatar for mitarcher 131. mitarcher Lv 1 2 pts. 7,827
  2. Avatar for Deleted player 132. Deleted player pts. 7,821
  3. Avatar for Idiotboy 133. Idiotboy Lv 1 2 pts. 7,817
  4. Avatar for data00 134. data00 Lv 1 2 pts. 7,787
  5. Avatar for Ofelya 135. Ofelya Lv 1 2 pts. 7,772
  6. Avatar for drumpeter18yrs9yrs 136. drumpeter18yrs9yrs Lv 1 2 pts. 7,763
  7. Avatar for Truncheon Luncheon 137. Truncheon Luncheon Lv 1 2 pts. 7,762
  8. Avatar for TJOK fan 138. TJOK fan Lv 1 2 pts. 7,760
  9. Avatar for Ernst Zundel 139. Ernst Zundel Lv 1 2 pts. 7,759
  10. Avatar for Festering Wounds 140. Festering Wounds Lv 1 2 pts. 7,756

Comments